SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000116417 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000116417
Domain Number 1 Region: 42-510
Classification Level Classification E-value
Superfamily Ras GEF 4.32e-120
Family Ras GEF 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000116417   Gene: ENSDARG00000033614   Transcript: ENSDART00000137801
Sequence length 514
Comment pep:known chromosome:Zv9:5:41314276:41411575:-1 gene:ENSDARG00000033614 transcript:ENSDART00000137801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKFLAELLGCTLPEKGASPMFECRSQPHIGLRHVTKQRDKMPQTPPFPVMYGSTNGYNK
NLYKAKEEDYEGLYYHDNNLISGSLEALIEHLVPTVAYYPDRTYIFTFLLSSRLFLHPYE
LMSKVCHLCVDQQRLSDPQADKARVRKIAPKILQLLTEWTETFPYDFRDERMMKSLKELT
HRLSTGEDLYRKAVQQMTQTLIRKLTTLSQYEEALAKINSSVTDRLTVLKTKPQSIQRDI
LTICNDPFTLAQQLTHIELERLSYIGPEEFVQAFVQKDPLDNDKNCFSDHKKASNLEAYV
EWFNRLSYLVATEICMPVKKKHRARVIEFFIDVARECFNIGNFNSLMAIITGMNMSPVSR
LKKTWAKVKTAKFDILEHQMDPSSNFYNYRTALRGATQRSITAHSSREKIVIPFFSLLIK
DIYFLNEGCANRLPNGHVNFEKFWELAKQVTEFMTWKKVECPFDRDRKILQYLLTAPVFS
EDALYLASYESEGPENNMEKDRWKSLRSSLLNRT
Download sequence
Identical sequences Q6DHR3
ENSDARP00000116417 XP_005165336.1.45394 7955.ENSDARP00000088652 ENSDARP00000116417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]