SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000116574 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000116574
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Histone-fold 3.44e-48
Family Nucleosome core histones 0.0000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000116574   Gene: ENSDARG00000094931   Transcript: ENSDART00000139269
Sequence length 127
Comment pep:known chromosome:Zv9:7:7241510:7241893:1 gene:ENSDARG00000094931 transcript:ENSDART00000139269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKAAKK
Download sequence
Identical sequences A4FVM2
ENSDARP00000116574 7955.ENSDARP00000093798 XP_001334871.1.45394 XP_020482227.1.8198 XP_020493401.1.8198 XP_020493402.1.8198 XP_020493403.1.8198 XP_020494144.1.8198 XP_020494145.1.8198 XP_020494147.1.8198 XP_020494148.1.8198 XP_020494149.1.8198 XP_020494163.1.8198 XP_020511845.1.8198 XP_020511846.1.8198 XP_020511847.1.8198 XP_020514263.1.8198 XP_020514264.1.8198 XP_020514265.1.8198 XP_020515585.1.8198 XP_020515995.1.8198 XP_020515997.1.8198 XP_020516739.1.8198 ENSDARP00000116574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]