SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118326 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118326
Domain Number 1 Region: 5-118
Classification Level Classification E-value
Superfamily Histone-fold 3.55e-56
Family Nucleosome core histones 0.0000096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118326   Gene: ENSDARG00000088276   Transcript: ENSDART00000143995
Sequence length 118
Comment pep:known chromosome:Zv9:24:35333778:35336191:1 gene:ENSDARG00000088276 transcript:ENSDART00000143995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSNEGAKKKGKAPGDKKGSKRKSKRRETYAVYIYKVLKQVHPDTGISSRAMSIMNSFVN
DVFERIATEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Download sequence
Identical sequences F1QMJ9
ENSDARP00000118326 ENSDARP00000118326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]