SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118941 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118941
Domain Number 1 Region: 110-428,456-551
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-112
Family Ras GEF 0.00016
Further Details:      
 
Domain Number 2 Region: 688-782
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-40
Family Ras-binding domain, RBD 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118941   Gene: ENSDARG00000042409   Transcript: ENSDART00000138959
Sequence length 813
Comment pep:novel chromosome:Zv9:8:31798010:31827536:-1 gene:ENSDARG00000042409 transcript:ENSDART00000138959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYIMGIQSDALGVKPTSLDELFESSTWRIKNIWDGVKLEIAAGDGCPVVLNSFTHLDPD
LPMLESSVQEIGEEVEDGAIYTITLRKVQLHQTASKGQRWLGVETDSALSLYETCKGRTI
KAGTLEKLVEYMVSAFKGKDYTYVTIFLCTYRAFATTKQVLDLLLNRYAKLPASGKTKVS
AEDHTELKNTVSSILGAWLDQYSEDFWSPPDHECLQSLISYLQLNFSGSDLERRALNLLE
HFQHRQQCEVEIEGDLCSCPFATPEESSLEDEFSPSHFMSFSPSIVAEQLTVMDAELFKR
VVPYHCLGGIWSQRDKKGKEHLAPTIRATVSQFNSVTNCVIATCLDNRSLRPFQRAKRIE
HWIEVARKCRILKSFSSLKAILSALQSNAIHRLRRAWDDVSRESYRTFQELSEIFSDDNN
YSLSRELLIKEGTSKSAIVEINHKGAQRRHQQQRDMGVVQGTIPYLGTFLTDLVMLDTAM
KDHLEVGLINFEKRRKEFEVIAQIKLLQLTCNYYNFSRNQRFIDWFKRVEKLTETESYSM
SCDIEPPSESLCKKNGGIMKRMSEESGYSSAASHSKSFEQPRLSQFKDCFKDGADSLSLT
SAGSSGSDADESLSLLNSPESGSQRLWESPTPSSLEASGSGLCLESGCSSSTSSSSSSSS
SVSAFTGRTFNFHKRSVSGISDYSSLSLPLYNQQANDCCIIRVSLDSENGNMYKSILVTS
QDKTPGVIRKAMAKHNLDNDKSEDYELLQRVSKHKELRIPDNGNVFYAMNSTANYDFLLR
KRGVPKTCRSKSSPSLTLPRMKQKGFKIPKSFF
Download sequence
Identical sequences B0S750
ENSDARP00000118941 7955.ENSDARP00000062180 NP_001116789.1.45394 ENSDARP00000118941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]