SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000126317 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000126317
Domain Number 1 Region: 12-141
Classification Level Classification E-value
Superfamily Histone-fold 1.93e-42
Family Nucleosome core histones 0.0000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000126317   Gene: ENSDARG00000059124   Transcript: ENSDART00000082147
Sequence length 145
Comment pep:known chromosome:Zv9:8:7852357:7854060:1 gene:ENSDARG00000059124 transcript:ENSDART00000082147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRHTSAHKRKPSTPRRRSPPASLPPPAGSRTRRHSGPSGSSPRKKHKFRPGTRALMEIR
KYQKSTGLLLRKAPFSRLVREVCQMFSREHMMWQGYALMALQEAAEAFMVRLFSDANLCA
IHAKRVTLFPRDIQLARRIRGVEHM
Download sequence
Identical sequences Q803H4
ENSDARP00000126317 ENSDARP00000126317 7955.ENSDARP00000076584 NP_001157712.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]