SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000004223 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000004223
Domain Number 1 Region: 344-446
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.07e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 76-141
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.28e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 160-214,242-260
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.4e-16
Family N-terminal PAS domain of Pas kinase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000004223   Gene: ENSDARG00000006791   Transcript: ENSDART00000023959
Sequence length 626
Comment pep:known chromosome:Zv9:25:18381074:18406100:-1 gene:ENSDARG00000006791 transcript:ENSDART00000023959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTMNEFMSQSSADLISSSIGTTGMDYNRKRKGSTTEYQIDGFSFDDSMDTD
KDKTLGRDEQQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLR
MAVQHMKTLRGATNPYTEANYKPAFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESV
YKILNYTQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGP
SRLCSGARRSFFCRMKCNRPSVKMEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKM
GLDEDNEPDNEGCNLSCLVAIGRLHPHIVPQPMNGDIRVKPTEYVSRHAIDGKFVFVDQR
ATAILAYLPQELLGTSFYEYFHQDDIGHLAECHRQVLQMREKISTNCYKFKIKDGSFITL
RSRWFSFMNPWTKEVEYIVSTNTVVSGSMLEGADPSYSQTASSPQSMDSVLTSGDGGGKR
PLQIVPGIPGGTRAGAGKIGRMIAEEVMEIQRIRGSSPSSCGSSPLNITATPPPDTCSPG
GKKIQNGGTPDLPSAGIVPGPDSIGYPYSNNSLMSDNSHLSIDIMEEPGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences Q9I879
NP_571652.1.45394 XP_005163079.1.45394 ENSDARP00000004223 ENSDARP00000124722 7955.ENSDARP00000004223 ENSDARP00000004223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]