SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000016938 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000016938
Domain Number 1 Region: 285-387
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.32e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00063
Further Details:      
 
Domain Number 2 Region: 39-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000183
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 
Domain Number 3 Region: 128-182
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000327
Family BphP N-terminal domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000016938   Gene: ENSDARG00000016536   Transcript: ENSDART00000014806
Sequence length 845
Comment pep:known chromosome:Zv9:5:24575014:24614052:1 gene:ENSDARG00000016536 transcript:ENSDART00000014806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEGVSMDNLSEFGGLCPSSRREWDTSSCVDDLMDEDEKDRAKRASRNKSEKKRRDQFNV
LIKELCTMLQGQGHPRKMDKSTILQRTIDFLQKQKEITAQTESCEVRQDWKPSFLSNEEF
TQLMLEALDGFLIALTTDGNIIYVSDSVSSLIGHLPSDMVDQNILNFLPEREHADVYKLL
SSHMLLTESSTVDLLNSNETHVEFCCHIARGNIDPKEPPTYEYVKFVGDFKFHNNVPLSS
CNGYDLAFPRTLQSSIEEQVCLVATVRLATPQFLKDLCNVEDVCDEFTSRHSLEWKFLFL
DHRASPIIGYLPFEVLGTSGYDYYHVDDLELIAQCHKQLMQCGKGKSCYYRFLTKGQQWI
WLQTHYYITYHQWNSKPEFIVCTHSVVSYAEVRAERRREFGLEESSSDMATSSIKGQEVF
LDMCPPLEATRDRINSARSVSSQSSRKSSHTALSDSASNSSVRYTEACTSSRQSASIGPE
KSSNRMTHTGTKTLIQRQSSSEPPSLSPSCSQHSAMTQSLYSFQQPQLGVMHQLKEQLEE
RTRILQADIKTQQQELHDIKEKLQLANLQMLLQQPIQGEFAGSGPQQQGPGRPAQQNTHP
KPQHCVSHSSHTLQPNSSSTQGQQRLVQAGHMQAVSVPMQTHTSLTTPFYSNPMMFSPNH
GHRSQHDTHCQRNTHADYSQDGQLRMLLNQPMQTLVQDSNGGPQSSQCTSTIQQTKYPLE
QQMMAPSFPVQQVNCNAVLVPSPVFTSPIMIPHNSFITHQTTPTYTTHPPVAPHSLPLQQ
PQQFFQMQPQGLIHGTPTQALFHTPSVPQQSTVGYVQPQQQQQQQQHHHHSQSGNLSDYR
NMLPR
Download sequence
Identical sequences Q8JIG3
NP_840084.1.45394 XP_005165177.1.45394 XP_005165178.1.45394 XP_021331698.1.45394 ENSDARP00000016938 ENSDARP00000016938 7955.ENSDARP00000016938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]