SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000022617 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000022617
Domain Number 1 Region: 89-183
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-29
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 9-65
Classification Level Classification E-value
Superfamily L27 domain 1.68e-22
Family L27 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000022617   Gene: ENSDARG00000013414   Transcript: ENSDART00000019748
Sequence length 218
Comment pep:known chromosome:Zv9:4:20687452:20787163:-1 gene:ENSDARG00000013414 transcript:ENSDART00000019748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVTVQPLTLERDVTRAIELLEKLQESGDVPGHKLQSLKKVLQSEFCTAIREVYQYMHE
TITVNGCPEYQARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYI
SRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLE
EMEARFEKLRTARRRQQQQILMQQQQQQNLAAQQNHMS
Download sequence
Identical sequences Q6PC63
NP_957003.1.45394 7955.ENSDARP00000022617 ENSDARP00000022617 ENSDARP00000022617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]