SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000027022 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000027022
Domain Number 1 Region: 13-351
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 6.02e-67
Family ADP-ribosylglycohydrolase 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000027022   Gene: ENSDARG00000019338   Transcript: ENSDART00000011706
Sequence length 370
Comment pep:known chromosome:Zv9:17:31670964:31678376:1 gene:ENSDARG00000019338 transcript:ENSDART00000011706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAARVVAPVMMLSRFRGALVGSVLGDCIGGEFEGAVDVPLDRVLQHLSALEDDTRGDG
ILQYSDDTAMMRCVADSLLTRMTFDERDMAQRFAKEYSHSPGRGYGSGVVQVLRKLASPH
LKDVFQPAQAQFGGRGSFGNGGAMRAVPFALAFRSRADVRKYSRFGAMLTHSCSLGYNGA
ALQALAVHLSLQGALALPKDFIDKLISEMEELEKDETAKHDAKALNLSEFPYCSRLHRVK
ELMDKTSVSIEEVISELGNGIAALQSVPTAIFCVLYCLEPQDGLPERFGGLERTIAYSLA
LGGDTDTIACMAGAIAGAHYGIDSIPLSWQVSCEGVDEADDLARRLYDLYCLPQHNEDRG
NNQPHTTNTD
Download sequence
Identical sequences Q66HT8
ENSDARP00000027022 NP_001004565.2.45394 7955.ENSDARP00000027022 ENSDARP00000027022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]