SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000046217 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000046217
Domain Number 1 Region: 31-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.4e-79
Family Calponin-homology domain, CH-domain 0.0000752
Further Details:      
 
Domain Number 2 Region: 1157-1274
Classification Level Classification E-value
Superfamily E set domains 3.34e-36
Family Filamin repeat (rod domain) 0.0000611
Further Details:      
 
Domain Number 3 Region: 1353-1465
Classification Level Classification E-value
Superfamily E set domains 3.57e-35
Family Filamin repeat (rod domain) 0.0000258
Further Details:      
 
Domain Number 4 Region: 1542-1661
Classification Level Classification E-value
Superfamily E set domains 2.8e-34
Family Filamin repeat (rod domain) 0.0000078
Further Details:      
 
Domain Number 5 Region: 1446-1558
Classification Level Classification E-value
Superfamily E set domains 1.13e-32
Family Filamin repeat (rod domain) 0.0000558
Further Details:      
 
Domain Number 6 Region: 1084-1178
Classification Level Classification E-value
Superfamily E set domains 1e-30
Family Filamin repeat (rod domain) 0.0000129
Further Details:      
 
Domain Number 7 Region: 1846-1941
Classification Level Classification E-value
Superfamily E set domains 2.87e-30
Family Filamin repeat (rod domain) 0.00000968
Further Details:      
 
Domain Number 8 Region: 776-890
Classification Level Classification E-value
Superfamily E set domains 1.8e-29
Family Filamin repeat (rod domain) 0.00065
Further Details:      
 
Domain Number 9 Region: 692-800
Classification Level Classification E-value
Superfamily E set domains 2.34e-29
Family Filamin repeat (rod domain) 0.00059
Further Details:      
 
Domain Number 10 Region: 496-593
Classification Level Classification E-value
Superfamily E set domains 7.34e-29
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 11 Region: 1262-1375
Classification Level Classification E-value
Superfamily E set domains 1.68e-27
Family Filamin repeat (rod domain) 0.0000243
Further Details:      
 
Domain Number 12 Region: 2030-2124
Classification Level Classification E-value
Superfamily E set domains 1.75e-27
Family Filamin repeat (rod domain) 0.0000271
Further Details:      
 
Domain Number 13 Region: 381-477
Classification Level Classification E-value
Superfamily E set domains 3.53e-26
Family Filamin repeat (rod domain) 0.00098
Further Details:      
 
Domain Number 14 Region: 2305-2395
Classification Level Classification E-value
Superfamily E set domains 4.14e-26
Family Filamin repeat (rod domain) 0.0000085
Further Details:      
 
Domain Number 15 Region: 2628-2717
Classification Level Classification E-value
Superfamily E set domains 1.13e-25
Family Filamin repeat (rod domain) 0.00000993
Further Details:      
 
Domain Number 16 Region: 584-686
Classification Level Classification E-value
Superfamily E set domains 4.94e-25
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 17 Region: 880-990
Classification Level Classification E-value
Superfamily E set domains 5.07e-25
Family Filamin repeat (rod domain) 0.0008
Further Details:      
 
Domain Number 18 Region: 2496-2587
Classification Level Classification E-value
Superfamily E set domains 1.13e-24
Family Filamin repeat (rod domain) 0.00000939
Further Details:      
 
Domain Number 19 Region: 281-377
Classification Level Classification E-value
Superfamily E set domains 7.34e-24
Family Filamin repeat (rod domain) 0.00092
Further Details:      
 
Domain Number 20 Region: 1671-1761
Classification Level Classification E-value
Superfamily E set domains 8.01e-23
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 21 Region: 2403-2492
Classification Level Classification E-value
Superfamily E set domains 3.74e-21
Family Filamin repeat (rod domain) 0.0000124
Further Details:      
 
Domain Number 22 Region: 978-1079
Classification Level Classification E-value
Superfamily E set domains 4.4e-21
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 23 Region: 2238-2319
Classification Level Classification E-value
Superfamily E set domains 2.54e-20
Family Filamin repeat (rod domain) 0.00022
Further Details:      
 
Domain Number 24 Region: 1784-1863
Classification Level Classification E-value
Superfamily E set domains 1.93e-16
Family Filamin repeat (rod domain) 0.0000944
Further Details:      
 
Domain Number 25 Region: 1943-2027
Classification Level Classification E-value
Superfamily E set domains 2.6e-16
Family Filamin repeat (rod domain) 0.0000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000046217   Gene: ENSDARG00000018566   Transcript: ENSDART00000046218
Sequence length 2719
Comment pep:known chromosome:Zv9:25:36081303:36101828:1 gene:ENSDARG00000018566 transcript:ENSDART00000046218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNYTHLDDLPPQYYQGTDLGEEEEEEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
NKGVTDLQKDLGDGLKLISLLEVLSQKKMYRKHHVRPNFRQMKLENVSVALEFLDRERIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDEDDEEVKKLTPKQRLLGWIQNKV
PELPINNFNKDWRDGKALGALVDNCAPGLCPDWQTWDPNQPVENAREAMQQADDWLGVPQ
VIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPVKPKQLYPKKAKAYGPGIEPQGNMVL
KPAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVL
FAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVV
IVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEAHL
KPPGAPKQIPPQKKKASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKG
PGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVR
AWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP
GDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAR
EAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFR
VLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEA
DIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGP
GINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTAL
HQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGKDQEFIVNTKGAGG
QGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVE
GLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDG
TCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVAS
FTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQV
PKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIIN
PSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVR
AYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTA
GDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGV
APLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSA
PSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNR
DGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLG
PNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYV
ITIRFGGQHIPKSPFQVMATDQPVAPRDDTKPMFQPLNLVIPFTVQQGELSGEVRMPSGK
TARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPG
LCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNI
IVKFDNSHIPGSPFTAKITGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKE
EPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFG
KGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNY
IINIKFADKHIPGSPFTVKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQML
SAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESF
LGRDRLGSFGTIRQEGETGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHT
VNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGL
SIAVEGPSKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVATLSDD
ARRLTVTSLQEKDLKVNQEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIR
FIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFV
VNTCKAGSGALSVTIDGPSKVKMDCNECQEGYKISYTPMAPGNYLICIKYGGPQHIVGSP
FKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLS
KAFVGQKNSFSVDCSKAGTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVV
IVKWGDETIPGSPFHVSAP
Download sequence
Identical sequences E7F1L7
ENSDARP00000046217 ENSDARP00000046217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]