SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000066948 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000066948
Domain Number 1 Region: 754-975
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-56
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 964-1084
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-24
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 3 Region: 1136-1312
Classification Level Classification E-value
Superfamily PH domain-like 8.97e-23
Family Pleckstrin-homology domain (PH domain) 0.0000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000066948   Gene: ENSDARG00000045528   Transcript: ENSDART00000066949
Sequence length 1315
Comment pep:novel chromosome:Zv9:4:24949709:24996004:-1 gene:ENSDARG00000045528 transcript:ENSDART00000066949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKPPVAPKPKLVPLHKPSPPPIAPKPEILLPSPSPTAHKRGKPAVAPKPCLLKAPQKPV
QARQDHCKNQHPPVSKNGGPALLSSNLSHYIIPPCNKVCHLANNKSNDSKEISREATLTT
EVGVFKEGDSPKEHLFSNDTWEHTARSEHVQEQVPTDSTQMSTEAQDETNSPSVEKDQTS
TQVLTSDHIPRHCPTEPLQERSSEVKETGNVFSSCTSDSVGVPAPPSKPLPVPHPRRPRR
ALLRQNVVEIAPSDTQADIPTETPENAQSDGLQETPKNTTCHSHTSTLQNACCPKEDIEN
TDTDSSTKSDPLHKVDSFYNAQTEDMPSDLDSTHYSVPTNGATLASMDTAVEDGSQPPAP
PPRQKSLPQMVDSLCKASTSVDNLLLHCQSDLQEVTSNDEDAESDDEDDGAYGDFARYPI
TRSLPKQIKLSCGSQVIAITKPYIDGDEKSPKVMPKKPQRNSLPASVALRKQGTPPPLPN
SNPPVFGELPAPPQEKPSWRVALPSIPLFSRNQPTRSNSQPQAGVVGSVFVKQRAKSFSS
ADLQRVDNGSEASEQLARSDQTRRSLRKLLELRVCARLLPKLLRSGQSLDCTRTDSEYEE
HKAVPANQVTSGDDEEAQGDSEADCGVEYENVPLYEEIPEYMNLPWVYSNQDADTDVYEV
QEPSMTVEFVNAFLTFISHWLVCDELSVPAKQRCAELAVGFQMHRTLNQACGRVFGNVSM
LPTNIYMSADLSEDGLSSNEEDGDSSDSSKEDMRHSKDKEEVERAKRNKVVHIAMEIMSS
EKVFVDVLKLLHIDFRDAVAKATRASGKPLVEEKVLNQILYYLPQLYELNKDLLKELEER
VAHWSDHQRLADIFVQKGPYLKMYSTYIREFDRNVALLDEQCRKNPPFSSVVRQFETSPR
CASLALKHYLLKPVQRIPQYQLLLTDYLKNLPEDSSDYKDTQTALSVVKEVANHANDIMK
QGDNFQKLMQVQYSLNGHHEIVQPGRVFLKEGTLMKLSRKVMQPRMFFLFNDILLYTTPV
QSGQYKVNSMLSLAGMKVSKPSQEAYQNELNIESVERSFILSANSATERDEWLEAIATAI
DDYTRKKISFFSSRSQELEGISDDGLPLGSKAPIWIPDLRTTMCMICTCEFTLTWRRHHC
RACGKVVCQACSSNKFYLEYLKNQLARVCDHCYIKLQHKGDQSNVTFSPSGRGSTFAFSR
KQKKIPSALKEVSANTENSSMSGYLHRSKGHKKPWKRLWFVIKNKVLYTYAASEDVAALE
SQPLLGFFLREEKTGPAQKLQFKLYHKNTLYYIFRAEDIPTAQRWIEAFQEAMIL
Download sequence
Identical sequences Q5RH33
7955.ENSDARP00000066948 NP_001093450.1.45394 ENSDARP00000066948 ENSDARP00000066948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]