SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000089031 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000089031
Domain Number 1 Region: 366-468
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.73e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 98-163
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.44e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 182-236,264-280
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000089031   Gene: ENSDARG00000035732   Transcript: ENSDART00000098259
Sequence length 646
Comment pep:known chromosome:Zv9:7:67945187:68002908:-1 gene:ENSDARG00000035732 transcript:ENSDART00000098259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTMNEFMSPSSTELISSSMGSTGMDFNRKRKGSITDYEIDGFSFESDSSWM
RFLIPSSQLTQSPESDRDSMDTDKDKPLGSRADQQMKNAREAHSQIEKRRRDKMNSFIDE
LASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGAANPYTEANYKPAFLSDDELKHLILKA
ADGFLFVVGCDRGKILFVSESVYKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTA
PRERLIDAKTGLPVRTDIAPSPSRLCSGARRSFFCRMKCNRSMVKMEDKDFPSTCSKKKA
DRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHPHIVPQPVNGDIR
VKPTEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSFYEYFHQDDIGHLAECHRQVLQ
MREKINTHCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVSGSSVDGAEPGFP
QLSASPQSMDSVLTAADGSGKTVPGLPGGTRAGAGKIGRMIAEEVMEIHRIRGSSPSSCG
SSPLNISNSTPPPDTSSPAARKMSNGGTPDIPSAGLGSGQDSIGYPYSNSSILSDNSHIG
IGDIMDEPGSSSPSSDEAAMAIIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences E7F4H0
7955.ENSDARP00000089031 ENSDARP00000089031 ENSDARP00000089031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]