SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101564 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101564
Domain Number 1 Region: 372-544,578-742
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.89e-82
Family YicI catalytic domain-like 0.00087
Further Details:      
 
Domain Number 2 Region: 127-369
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.22e-42
Family YicI N-terminal domain-like 0.0066
Further Details:      
 
Domain Number 3 Region: 745-825
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.15e-18
Family Putative glucosidase YicI, domain 3 0.0095
Further Details:      
 
Domain Number 4 Region: 98-157
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000693
Family Trefoil 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101564   Gene: ENSDARG00000074282   Transcript: ENSDART00000110790
Sequence length 956
Comment pep:known chromosome:Zv9:1:8577463:8599643:-1 gene:ENSDARG00000074282 transcript:ENSDART00000110790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSYERLTPEEVHFSGAALLDNDESTDADLKEGDPELPLLPQSPRCSITAALLTLGGLIV
VLSAVWLLGTLFWIHNPPSTESHRPPSPKSQNGTGLQPESCSQVPEGWRFDCYPERNVVV
TEDMCHARNCCFIQSSRGNVSAQNGVPWCFYTPDYPSYELMSIVDTEMGKVGKLLRNKKT
YYPKDIDALQLEVLFEEDHRLRVKITDPTEKRYEVPIDVPVVHKRASNPSYTVDFIKEPF
GLIVKRTQTGAVLLNTSIAPLFYADQFLQMSSSLPTRFIYGLGEHRSNFLHDVQWNTLTM
WARDVPPMELTNLYGVHPFYLSMESDGNAHGFFMLNSNAMDVVLQPAPAVTWRMIGGILD
FYIFLGPDPSSVIGQYLDVVGKPAMPIYWALGYHLCRWGYKTSNKTWSVVKEMRNYGIPQ
DVQWNDIDYMDRSLDFTYDPSGFSTLPDLVKDLQRHDQHYVMILDPGISNSQPPGSYWPF
DEGKKKGIFINDSNGDILIGKVWPGLTAFPDFSNPDTHEWWYQNLQRFHNKVPFDGVWID
MNEPSNFFDGSLNGCPDNELENPPYTPGILGGTLKGKTVCASARQKISVHYNIHSLYGLM
EAQATESALRRITKKRPFIISRSTFPSQGKYSGHWLGDNRSQWKDLATSIPGMLTFNILG
IPLIGADICGFGGSTTEELCVRWTQLGAFYPFTRNHNSIDEQDQEPTAFSPAARTAMKEA
ILLRYSLFPHLYTLFHHAHVSGHTVATPLLFQFPTDEKTYGIDKQFLWGKSLLVTPVLDA
GRDYVVGYFPKGLWYDFHTGNSLISSGEEIKLEAPADKINLHLREGSVIPTQRPNTTLWV
SSGQPLHLIVSLSEDGRAKGDLYWDDGETIDSYESNQYAYIYFTVEQNTMMSEVLHNHEE
ATYITVETASFYGVKAKPENVTVNSQEAAFTYLDNQVLTVTDLGLNLSHNFTISWM
Download sequence
Identical sequences E7FCP7
ENSDARP00000101564 ENSDARP00000101564 XP_002660410.1.45394 XP_005170936.1.45394 XP_021331622.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]