SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102718 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102718
Domain Number 1 Region: 320-495,530-696
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.46e-78
Family YicI catalytic domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 1187-1380,1426-1588
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.26e-72
Family YicI catalytic domain-like 0.00029
Further Details:      
 
Domain Number 3 Region: 75-318
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.13e-45
Family YicI N-terminal domain-like 0.0057
Further Details:      
 
Domain Number 4 Region: 935-1156
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-32
Family YicI N-terminal domain-like 0.015
Further Details:      
 
Domain Number 5 Region: 1590-1670
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.81e-21
Family Putative glucosidase YicI, domain 3 0.0073
Further Details:      
 
Domain Number 6 Region: 699-765
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.24e-16
Family Putative glucosidase YicI, domain 3 0.012
Further Details:      
 
Domain Number 7 Region: 48-97
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000345
Family Trefoil 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102718   Gene: ENSDARG00000075118   Transcript: ENSDART00000110351
Sequence length 1809
Comment pep:known chromosome:Zv9:18:2817706:2934138:1 gene:ENSDARG00000075118 transcript:ENSDART00000110351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRRFSGLEVTLMVLFALALVVAVALIVVLATGEPGTIREGSDPDIVPECPDIPLTDRV
DCFPDGGASQQKCLERACCWSPLDETNVPWCFFSKNHGYTADRVSNPDSTHIEAKLTRMN
APSLFGADIKDLTFHGEMQTENRFRFKITDAKQARFEVPHENVKAPANPPTGPLKYKVEI
VQKPFGVKIWRTTPEKLLFDTTIGPLVFADQYLQLSAKLPSHNIYGLGEHVHQTFRHDTN
WRTWPIFTRDSFPNGGTHNLYGHYPYFTCLEDESGQSIGVFLMNSNAMAEVTIQPAPAVT
FRTIGGVLDFYVLVGDTPEAVVDEFTKLIGRPFIPPYWSLGFQISRWDYGSLDAVKEVVE
RNRNASLPYDVQYTDIDYMEEKKIFTYDLVKFADLPNFADYMHDKGQKYIVILDPAVSTG
RRLNGPYDTVDRGHAAKVWVTESDGETPLVGEVWPGETVFPDFTNEACIKWWVDEISRFH
KEVKHDALWIDMNEISNFIKGSNKGCADNKLNYPPFTPRILDDLMYSKTLCMDAKQKWGN
HYDVHSLYGYSMVLATERASKEVFGTNRSMVFTRSSFPGVGKYSGHWLGDNGANWNDIKW
AIPGMLEFNLFGIPYIGADICGFFDNSTEELCRRWMQVGAFYPFSRNHNAQGYEDQDPAS
YGLDSLLVNTSRHYLNIRYKLLPYLYTLFYKAHVNGETVVRPLMHEFYSDSQTWDIHKQF
MWGAHLLITPVLDPGVHYVEAYIPDAIWYDFENGNRLLGRKVRVCTFLPNNLLGYHRENV
YIYMMKVVCSPSRRHPMGLIIALDDNKSASGELFWDDGDSRDTVSSGNHIHYQFSVTDGS
LTMHVTKNGYSDPNNLKFENITILGFSSAPPFVLVSDGTTSNPLPQSQIQYDSVKQVLNL
RNLELELGKSYTISWEAKAERIDCYPEEGATKAECEGRGCIWEPKSESLSVPMCYYSENH
GYKASNVVENMYGITADLEINTAFPSQRSQSPDINKLRVEITFHDEICLRWKIYDPEKAR
YEVPVPLNLPNPPPLWGEQTYKVEINEEPFGIRVIRKDTSEVIFDSVLPGFIFSDQFIQI
STRLPTEYVYGFGETEHPSYKHDLNFHTYGLFAKDQPPGYKLNSYGIHPFYMGMEKSKKA
HGILLLNSNAMGLKVAIRAAAIYQRREAVIELFYKKEPVKTLTYKCFVQLIGRPVLPAYW
SLGFQLCRYGYANDSEIADLYRDMRAAEIPYDVQYADIDYMERQMDFTLDKTNFLGLPAL
VDRMRGEGMRFIFILDPAIAANETTGSYAAFDSGIEKDVFIKWPPALSNDIVWGKVWPDY
PNITVDNSLDWDTQVELFRSFVAFPDFFKNGTAEWWADQIKDYYDNVMKFDGLWIDMNEP
ASFVHGTVGGKCLGDPLLENPPYMPPLESKEKGLNHKTLCMNSEQILADGTRVRHYDVHN
LYGLSHTKPTYDALHSTTGKRGVIITRSTYPTSGRWAGHWLGDNYSAWDQLLKSIIGMME
FSIFGVSYTGADICGFFNPAQKEMCLRWMQLGAFYPFSRNHNTINMPRQDPVAWGPEFAN
MSRDVLNIRYTLLPYLYTLMYEAHTKGTTVVRPMLHEFVNDEKTWDIDRQFLWGSALLIT
PALEEGVTVVKGYLPKTRWYDYHTNEVVEGQGQFVDMDTPLDKINLHVRGRYIIPYQNPE
RNTQLSRKNPMNLLVALDGSGYATGNLFWDDGEGIDTLKNRKYIYKQFSASRGSLSGVRE
TGLEEADRPLLGEVKVLGVSSSVTEVTITVTGGSTTPLTFDYYPETQVLIIHVTPQKFKI
DEYFNIVWK
Download sequence
Identical sequences ENSDARP00000102718 ENSDARP00000102718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]