SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110017 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110017
Domain Number 1 Region: 337-439
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.17e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 147-201,229-244,272-290
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.23e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.079
Further Details:      
 
Domain Number 3 Region: 54-119
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000314
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110017   Gene: ENSDARG00000021855   Transcript: ENSDART00000121648
Sequence length 746
Comment pep:known chromosome:Zv9:16:5510608:5554146:-1 gene:ENSDARG00000021855 transcript:ENSDART00000121648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSANPDMSEVPSLAMTSSNGSHSNGVQKANKRQATSDYEDDEGGKLFRCDDDGGGSNDK
ERFARENHSEIERRRRNKMTAYITELSDMVPACSALARKPDKLTILRMAVSHMKSLRGTG
NTSTDGTYKPSFLTDQELKHLILEAADGFLFVVSCETGRVVYVSDSVTPVLNQAQSDWLG
SSLYDQLHPDDVEKLREQLSTTENNNNSGRMLDMKTGTVKKEGGQATVRMSMGARRSFIC
RMRCGVCPVEPVSLNRLNFLRTRNRNGLGSAKDGEQQYVVVHCTGYIRSWPPAGMNLSEE
EADNNQGNRFCLVAIGRLQVTCCPSDTSINNISVPVEFISRHNSQGVYTFVDHRCTATVG
FQTQELLGKNILDFAHPEDQGLLRDSLQQVVKLRGQVMSVMFRFQSKSREWVWMRTSSFT
FQNPFSEEIEYIICTNTNVNRGSSEGSVSPLSSPSLGQSPNCPSTPSPGCVTVRQLQQQQ
VELDGGGMSQEAPYENSQVTLPQVSVQTCGVVSADHSSKAVSSSVSSGQQVYPPAAAFPS
PARPTETFRSPVLPQQMVSVAHSAGQMLAQMSRQSTPSGVSGSNNSPIQAPSGPTAPPGL
WSTTRQPFSTQVAGPIGKNQSAPFNMGGFSSASAPSTSSSFGQMGGASASMASTSSYQQI
NSHSNPSTNGYGDVGQMAAAFGSRPAEGVTGWQQWPSQTHTQASADTQVQNNQTDIFPDV
LSMLDQSGSFSNGDFSEMPMFPPFPE
Download sequence
Identical sequences E7FDK6
XP_005157910.1.45394 ENSDARP00000110017 ENSDARP00000110017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]