SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112093 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112093
Domain Number 1 Region: 331-504,539-701
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.88e-92
Family YicI catalytic domain-like 0.00037
Further Details:      
 
Domain Number 2 Region: 87-329
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.16e-43
Family YicI N-terminal domain-like 0.0021
Further Details:      
 
Domain Number 3 Region: 705-785
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.63e-21
Family Putative glucosidase YicI, domain 3 0.003
Further Details:      
 
Domain Number 4 Region: 60-112
Classification Level Classification E-value
Superfamily Trefoil 0.000000000942
Family Trefoil 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112093   Gene: ENSDARG00000090714   Transcript: ENSDART00000127796
Sequence length 918
Comment pep:known chromosome:Zv9:3:18142401:18164333:1 gene:ENSDARG00000090714 transcript:ENSDART00000127796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIIRCLNTFAVLTCVLLIIVYEDNTICVAFSPSKERQHSSNISYRIIKAQKYSHNVSTV
PRDQCGIAVERRIDCARDRSLSRAECESRGCCYLPLPQSGLRGPPWCFYTVFYPGYKMGP
MLPTERGHRAILTRSAPSYLPRDIHTLQLDVMAETQDRLHLTLKDPTSPRYEVPFVKSQS
KGHKSMENPLYDVDFQPEPFGFSVRRKSNGRVLLNTTIGPLLFADQYLQLSTSLASSTVS
GLGEHYTPITLDLDWSSVSLWNRDMAPHRSANLYGSHPFFLVQEGDGQAHGVFLLNSNAM
EVFMQPAPALTWVTIGGILDFFIFLGPSPQSVIQQYQEVIGYPMMPPYWSLGFHLCRWGY
TSTNITRTVVQLMRQAKIPLDVQWNDLDYADQRRVFTFDPQRFGDLPQMVEDFHQLGMKY
VLILDPGISSASPPGSYKPFDDGLKKGVFINNSTGQILIGKVWPGPTAFPDFTNPTTQDW
WMDWIKDFYNKVPVDGLWIDMNEPSNFVQGSVDGCPDSELEKPPYTPGVIGGQLNSGTLC
VSAQQYLSNHYNLHNLYGLTEAIATHRALLKVKKTRPFVLSRSSFPGLGRFSAHWTGDVR
SDWEQLRFSIPAVLLFGLYGIPLVGADVCGFGGDTNEELCVRWTQLGAFYPFMRNHNDRP
NAPQEPYVFSQRAQDAMRMVINLRYSLLPFLYTLFHHAHTSASTVARPLFLQFPTDPDCR
SIDRQFLWGSSLLISPVLEQGAVEVMAYLPPGTWYSLHNGQTYYSKGQYIVFPASLDTII
VHVRERSIIPQQAPALTTAISRKNPFTLTVGLSVGNLAKGELFWDDGESLDTFERGDYSY
LLFFAEESYVVSKPIKLNGSLDGLVLGEVRVFGVQTPPTAVWANGQKVPDFSYRLDTKVL
TVAGLELPMTAKITIQWS
Download sequence
Identical sequences XP_001921957.2.45394 ENSDARP00000112093 ENSDARP00000112093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]