SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112866 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112866
Domain Number 1 Region: 101-195
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-30
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 22-76
Classification Level Classification E-value
Superfamily L27 domain 9.42e-22
Family L27 domain 0.0000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112866   Gene: ENSDARG00000037932   Transcript: ENSDART00000139644
Sequence length 220
Comment pep:known chromosome:Zv9:3:32070871:32081685:1 gene:ENSDARG00000037932 transcript:ENSDART00000139644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSSYYHTGKEVDMAAMTEPLCLERDVCRVIELLDRLQRSGQLPPPKLQALQRVLQSKFC
AAIREVYEQLYDTLDIIGGPEVRAQATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNI
MGGKEQNSPIYISRVIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGSV
KLVVRYTPKVLEEMEARFEKMRSARRRQQHTSYSSLESRG
Download sequence
Identical sequences F1RDK3
ENSDARP00000112866 ENSDARP00000112866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]