SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507379552|ref|YP_008017846.1| from Spiroplasma chrysopicola DF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507379552|ref|YP_008017846.1|
Domain Number 1 Region: 342-361,411-636
Classification Level Classification E-value
Superfamily HAD-like 5.04e-41
Family Meta-cation ATPase, catalytic domain P 0.0011
Further Details:      
 
Domain Number 2 Region: 149-240
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.66e-20
Family Calcium ATPase, transduction domain A 0.007
Further Details:      
 
Domain Number 3 Region: 108-141,242-335
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000811
Family Calcium ATPase, transmembrane domain M 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507379552|ref|YP_008017846.1|
Sequence length 646
Comment copper transporter ATPase [Spiroplasma chrysopicola DF-1]
Sequence
MVGQKKHKWSKRQIRNTYELVLAICCNLPLLLAMIPGLSILHNQWLQLGLTSVILFYCGR
NYYLNMYREIFKWHSIGMNTLIGLGTLIAYGYSIYIIASASSYMLLFEVAGTIITMMLIG
NLINTSVQQKVTAGIKDVVSLQAQSANLVDKDNNIIIVNTRLVKIDDLLVVRKGEKVPVD
GAITSGVGYLNEAMLTGESAIMTKKVGDHVIGGTINMGEPFYFKAQKVGSETVLANILQK
VDEIQSQKPRMQRIADRIAKWFTPFILLIALTTFLAQYYYFNSTNLPKAINIAITVIVIS
CPCALGLATPLAVAVGFGKAIKEGIIFNNTSAFEKINKIDAIAFDKTGTITTGVLTVEKI
IGATENYRFIYQLEKLSAHPIAKSIIAFFDQKSFPDIKFTNFTEQPGRGLTGEYQNNHYQ
LLSYSDAVAMKYTNVIKNEVALLTQPNATLVALTINKTITNVIVLTDQIRSDAQSTITKF
KKQGIELHMISGDNLASVKITADILGIPNYHGQVDPMLKAQIVKTIQGNGKVTAYVGDGI
NDLVALQQADFAIAMGEENAGAVNGSDITIIRPSIFNIYKAFVVTKLTRKIIWTNFFWAF
SYNLITIPLAMVGIIPPILGAVVMGFSQLVVLLNSLVFNQIKLKFK
Download sequence
Identical sequences R4U3K2
WP_016338908.1.79381 gi|507379552|ref|YP_008017846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]