SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507379655|ref|YP_008017949.1| from Spiroplasma chrysopicola DF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507379655|ref|YP_008017949.1|
Domain Number 1 Region: 205-341
Classification Level Classification E-value
Superfamily CBS-domain pair 1.26e-23
Family CBS-domain pair 0.0055
Further Details:      
 
Weak hits

Sequence:  gi|507379655|ref|YP_008017949.1|
Domain Number - Region: 6-159
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00353
Family LacY-like proton/sugar symporter 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507379655|ref|YP_008017949.1|
Sequence length 443
Comment hymolysin-related protein [Spiroplasma chrysopicola DF-1]
Sequence
MIDTTTIFVVLLPLMIILLILSAFFSASETAITSINVIRLKQMARGKLQINSSKAKKRSI
KKAKRVYKFVKDYDRTLATILIINTLVNTALATVGSLFFTNIINSAETATWVATVVIGVL
VLIFGELVPKTIVKRFPEKFSIFAAYILTFWKILVYPFTWFLVLKKHHAGVSTTENELLE
LISTIESEGVLEKNEKKLIESAIVFDEKNVGSVMRQKNKVKWIYSDIPWRELQTFYKEER
YTRMPVLDRKTDLVIGLLNIKDVFIALIDHETLDFKKLSTEPIFLSRYLKLDDALEIMQQ
EQIHMAIVSSSKDSNDFLGVVTMEDILEELVGEIYDEDDETGSVKEIGHHMFWIHGNMRV
PKVFQKYLQIAAPPDTHDKTLYQWFVSQTNYDIKNPNPSTNEFIYHNYAFRINNKKTRRG
NVKGIMFEIESLTDLKPDDDLED
Download sequence
Identical sequences R4UIQ5
gi|507379655|ref|YP_008017949.1| WP_016339011.1.79381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]