SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006631 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000006631
Domain Number - Region: 4-50
Classification Level Classification E-value
Superfamily Heme oxygenase-like 0.0445
Family Heme oxygenase HemO (PigA) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006631   Gene: ENSCAFG00000004447   Transcript: ENSCAFT00000007164
Sequence length 236
Comment pep:known_by_projection chromosome:CanFam3.1:22:3255795:3263506:-1 gene:ENSCAFG00000004447 transcript:ENSCAFT00000007164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYLTWLNKDPDEVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCG
IKYIKDDVLLNEPSADAPAARYQTIEENIKIFEEDEVEFISVPVPEFADSDPANIVHDFN
KKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIE
NIDHLGFFIYRLCHDKETYKLQRRETIRGIQKREVSNCVTIRHFENKFAVETVICP
Download sequence
Identical sequences F1PQ10
ENSCAFP00000006631 ENSCAFP00000006631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]