SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006917 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006917
Domain Number 1 Region: 141-363
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-55
Family C-terminal domain of adrenodoxin reductase-like 0.00000000419
Further Details:      
 
Domain Number 2 Region: 37-199
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 4.47e-18
Family N-terminal domain of adrenodoxin reductase-like 0.00000465
Further Details:      
 
Domain Number 3 Region: 364-491
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000051
Family N-terminal domain of adrenodoxin reductase-like 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006917   Gene: ENSCAFG00000004638   Transcript: ENSCAFT00000007472
Sequence length 492
Comment pep:known_by_projection chromosome:CanFam3.1:9:5567391:5577478:1 gene:ENSCAFG00000004638 transcript:ENSCAFT00000007472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRCWRWWPWSAWRRARPPPAGSTPSFRQQFSTQEQPPQICVVGSGPAGFYTAQHLLKH
HPRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSGRCAFHGNVVVGRDVAV
PELQAAYHAVVLSYGAEDHQALEIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTA
VILGQGNVALDVARILLTPPEYLEKTDITEAALGVLRQSRVKTVWIVGRRGPLQVAFTIK
ELREMIQLPGTRPILDPTDFLGLQDRIKEVPRPRKRLTELLLRTATERPGAEEAARQASA
SRTWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGVGEAARAVPTGDSEDLPCGLVLSS
VGYKSRPIDPSVPFDSKRGVIPNMEGRVIDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQ
MLLQDLKAGLLPLGPRPGYAAIEALLSSRGVRPVSFSDWEKLDAEEVSRGKGAGKPREKL
LDPQEMLRLLGR
Download sequence
Identical sequences E2RDC3
XP_533117.2.84170 ENSCAFP00000006917 ENSCAFP00000006917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]