SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009191 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009191
Domain Number 1 Region: 65-117
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000196
Family LEM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 322-381,409-463
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000414
Family Ankyrin repeat 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000009191
Domain Number - Region: 220-255
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00889
Family N-terminal domain of RNase HI 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009191   Gene: ENSCAFG00000006101   Transcript: ENSCAFT00000009903
Sequence length 959
Comment pep:known_by_projection chromosome:CanFam3.1:26:379346:405414:1 gene:ENSCAFG00000006101 transcript:ENSCAFT00000009903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWPRLAAAEWAALAWELLGASVLLFAVRWLVRRLEKRPQGLARSGPSAPLAGAATTSAP
GEMTMDAILARLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLEHGRTLPSY
PPGLDTSDATTLSKDAQRVLKSAVGSQAEQVGLSEDRDFGYSMGLNPPEEDVMTSKTCSM
PFSATTGVSGHKAMVRASVEQPLYYGVCPAYEDIPARNERIHVYEDRKDALQAVKMIKGS
RFKAFSTREDAEKFARGICDYFPSPSKASLPLSPVKVAPLFSSGGLKDGLYLSESETVNR
ERANSYKTPRTQDLTAKLRKAVEKGEDDTFSNLTWSNPRYLIGSGDNPTIVQEGCRYNVM
HVAAKENQASICQLTLETLENPEFMRLMYPDDDPNMLQQRICYIVDLYLNTPDKVGYDTP
LHFACKFGNADVVNVLSSHPLIVKNPRNKYDKTPEDVICERSKNKSLELKEQIREYLKGH
YYVPLLRAEDTSSPVIGELWSSDQTTENSHIGHSGGGPRDPVLTLRAFAGPLSPSKAEDF
RRLWKTPPREKAGFFHNVRKTDPERGIERVGRELAHELGYPWVEYWDFLGCFVDLSSQEG
LQKLEEYLTHQEAGKKAQQDSGENEASHQENPFGHARKCSNSISVRAFLDEDDDLSLEEI
KNRQNMARNNTQPTISTFGDSKCDILPLEQKTNLIEASTLTSPHSSKNGFFSHLSSGRTL
GRKQPEAPSTEEALLSSVSGLTVELDKLNLEDLGSNFSKTPNKITKSRDRKSLTSRMDVV
ESDSLEPPAVDTLRNNQSRTESEMSAKIAKIRLGPDAPVHKAQQSGSVSSEPSGVPTTKE
PVQRLFLFGEEPSKLDRDVLAALEYANVDPQQYPAVHRWKSAVLCYSPSDRQSWPSPALK
GKLESHQPDLGCPHSCSPGRSPGKPGPTHSPGLGNAGRYSPASGSHLRRMARLAQLTAL
Download sequence
Identical sequences E2R7S4
ENSCAFP00000009191 XP_005636126.1.84170 ENSCAFP00000009191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]