SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010872 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010872
Domain Number 1 Region: 49-462
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 3.93e-99
Family Iron-containing alcohol dehydrogenase 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010872   Gene: ENSCAFG00000007326   Transcript: ENSCAFT00000011731
Sequence length 467
Comment pep:known_by_projection chromosome:CanFam3.1:29:16019246:16053506:1 gene:ENSCAFG00000007326 transcript:ENSCAFT00000011731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARARAAHLLRLLQRAACQCPTHSHTYSQAPGFPPSGKTTDYAFEMAVSNIRYGAGV
TKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQMVMDSLVKNGINFKVYNNVRVEPTDRSFM
EAIEFVKKRAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVNAPIGKGKPVSVPLKP
LIAVPTTSGTGSETTGVAIFDYEPLKVKTGIASRAIKPTLGLIDPLHTLHMPDRVVANSG
FDVLCHALESYTALPYHMRSPCPSNPITRPAYQGSNPISDIWAVHALRIVAKYLKRAVRN
PDDLEARSNMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKDYNVDHPLVPHGLS
VVLTSPAVFTFTAQMSPERHLETAEILGADTRTARIPDAGPILADTLRKFLFDLDVDDGL
AAIGYSKADIPALVKGTLPQERVTKLAPRPQSEEDLSALFEASMKLY
Download sequence
Identical sequences F1PRA0
ENSCAFP00000010872 XP_849448.2.84170 ENSCAFP00000010872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]