SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014003 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014003
Domain Number 1 Region: 27-252
Classification Level Classification E-value
Superfamily CutC-like 4.05e-77
Family CutC-like 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014003   Gene: ENSCAFG00000009524   Transcript: ENSCAFT00000015131
Sequence length 259
Comment pep:known_by_projection chromosome:CanFam3.1:28:12624390:12650904:1 gene:ENSCAFG00000009524 transcript:ENSCAFT00000015131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQGAPSERKRARIPSGKAGTANGFLMEVCVDSVESAVNAERGGAGRIELCSGLLEGGT
TPSMGVLQVVKQCVQIPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLYGADGLVFGALT
EDGNIDKELCMSLVAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALE
GLPLIKRLIDQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSARDSGMKFRNSSV
AMGASLSSSEYSLKDSHSL
Download sequence
Identical sequences E2R9Z0
ENSCAFP00000014003 XP_005637665.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]