SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015342 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015342
Domain Number 1 Region: 73-110
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000419
Family Ribosomal protein L36 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015342   Gene: ENSCAFG00000010448   Transcript: ENSCAFT00000016580
Sequence length 110
Comment pep:known_by_projection chromosome:CanFam3.1:34:11001777:11002109:1 gene:ENSCAFG00000010448 transcript:ENSCAFT00000016580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVLVRKVLVSALSPLPRLSPHLAMPRALSTLLPGPFRAAGATGTKFTVWGLMGPVPLP
GPLLPGLQPALGFKTKGVIKERCRDCYRVKRRGRWYIYCKTNPKHKQRQM
Download sequence
Identical sequences E2RNM7
9615.ENSCAFP00000015342 XP_545188.2.84170 ENSCAFP00000015342 ENSCAFP00000015342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]