SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027196 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027196
Domain Number 1 Region: 46-183
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 3.66e-45
Family Molybdopterin synthase subunit MoaE 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027196   Gene: ENSCAFG00000018415   Transcript: ENSCAFT00000029248
Sequence length 185
Comment pep:known_by_projection chromosome:CanFam3.1:4:62156023:62185492:1 gene:ENSCAFG00000018415 transcript:ENSCAFT00000029248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISSSTFSQEMKLPSSPPLVEGSALEPFRKDLNEIEEKPKDIIKFTAEKLSVDEVS
QLVISPLCGAVSLFVGTTRNNFEGKKVISLEYEAYLPMAENEIRKICSDIRQKWPVKHIA
VFHRLGLVPVSEASVIIAVSSVHRASSLQAVSYAIDTLKAKVPIWKKEMYEESSSSWKRN
KECFW
Download sequence
Identical sequences E2RI62
ENSCAFP00000027196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]