SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027485 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027485
Domain Number 1 Region: 162-345
Classification Level Classification E-value
Superfamily vWA-like 0.00000000371
Family Integrin A (or I) domain 0.042
Further Details:      
 
Domain Number 2 Region: 650-758
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000753
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027485   Gene: ENSCAFG00000018621   Transcript: ENSCAFT00000029569
Sequence length 1210
Comment pep:known_by_projection chromosome:CanFam3.1:5:45556738:45676333:-1 gene:ENSCAFG00000018621 transcript:ENSCAFT00000029569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQRIFNSFVYTEKISNGESEVQQLAKKIREKFNRYLDVVNRNKQVVEASYTAHLTSPLTA
IQDCCTIPPSMMEFDGNFNTNVSRTISCDRLSTTVNSRAFNPGRDLNSVLADNLKSNPGI
KWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQL
QIAKDAARVILSAIDEHDKISVLTVADTVRTCSLDQCYKTFLSPATSETKRKMSTFVSSV
KSLDSPTQHAVGFQKAFQLIRSTNNNTKFQANTDMVIIYLSAGITSKDSSEEDKKATLRV
INEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVLDRTTLPVIKGSMM
VLNQLSNLEITVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIMTVSKPCYFGNLLLGIVG
VDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIP
KFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLRATGKEAYNVSYAWKMVQDTSFILCI
VVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQLATLESPTVMLSAGSFSS
PYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVMATSHVTDEWMTQMEMSSL
NTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLISLTGPYLDVGGAGY
VVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLPVCNQDGGNKIRCFIMEDR
GYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCNSFSDRTVQRFYKF
NTSLVGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNETCDSLAFCACSMVDRLCLNCHRM
EQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYTAIDPGLQDALHQCVNSRC
SQRMESGDCFGVLDCEWCMVDSDGKTHLDKSYCAPQKECFGGIVGAKSPYVDDMGAIGDE
VVTLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSHQHMSPLAAQEMSVRMSNL
ENDRDERDDDSHEDRGIISNTRFIAAVIERHAHSPERRRRYWGRSGTESDHGYSTMSPQE
DSENPPCNNDPLSAGVDVGNHDEDLDLDTPPQTAALLSHKFHHYRPHHPTLHHSHHLQAA
VTVHTVDAEC
Download sequence
Identical sequences E2RFW2
ENSCAFP00000027485 ENSCAFP00000027485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]