SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028415 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028415
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.09e-37
Family Ribosomal protein L20 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028415   Gene: ENSCAFG00000019259   Transcript: ENSCAFT00000030578
Sequence length 149
Comment pep:known_by_projection chromosome:CanFam3.1:5:56553573:56558110:-1 gene:ENSCAFG00000019259 transcript:ENSCAFT00000030578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFLTAQLWLRSRLTDRYWRVQKVLQHARHFRGRKNRCYKLAVRAVTRAFVKCTKARRLK
KRNMRTLWINRITAASQEHGLKYPAFIVNLIKCQVELNRKVLADLAIYEPKTFKSLAALA
KRRRLEGFAAALGDGKEPEGIFSRVVQHH
Download sequence
Identical sequences E2QZ57
9615.ENSCAFP00000028415 XP_536709.1.84170 ENSCAFP00000028415 ENSCAFP00000028415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]