SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030397 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030397
Domain Number 1 Region: 17-163
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.57e-38
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030397   Gene: ENSCAFG00000012837   Transcript: ENSCAFT00000020358
Sequence length 188
Comment pep:known_by_projection chromosome:CanFam3.1:26:23735182:23735748:-1 gene:ENSCAFG00000012837 transcript:ENSCAFT00000020358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPPCTFPVQFRQPVVSGLSQITSSLYISNGVAANNKLMLSSNQITTVINVSVEVVNTL
YEDIQYVQVPVADTPISRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPMGVIPDIYEK
EVHLMIPL
Download sequence
Identical sequences E2R784
XP_003433450.1.84170 ENSCAFP00000030397 ENSCAFP00000030397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]