SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000032945 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000032945
Domain Number 1 Region: 22-133
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 6.28e-23
Family Ribosome-binding factor A, RbfA 0.00000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000032945   Gene: ENSCAFG00000024219   Transcript: ENSCAFT00000037436
Sequence length 263
Comment pep:known_by_projection chromosome:CanFam3.1:1:692602:722173:-1 gene:ENSCAFG00000024219 transcript:ENSCAFT00000037436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKPSRLDFLTKTTAKKPRRDDHVRLRALNGLLYKALMDLLCTPEVSQEICDLDVQLSKV
SLTADFSACRVYWKTTVSAKQSAHTEAVLRGSAAHMRHLLMAQQILRNVPPIVFIQDRGS
LALAEVDRLLASADFGAPDKKEDSVQDDVRSPRALDAPTQQGTLASTTCSSLCGIDHEAL
NKQIMEYKKQRGQGCRTVSPEVSQLTAGLASQTRAGKVVAVPCADGDLSPRNHLSGAGST
KPHPDLGGAWGVDSSSEEQSRGQ
Download sequence
Identical sequences F1PP66
ENSCAFP00000032945 ENSCAFP00000032945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]