SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036802 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036802
Domain Number 1 Region: 27-321
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 1.28e-90
Family Glutaminase/Asparaginase 0.000000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036802   Gene: ENSCAFG00000018317   Transcript: ENSCAFT00000043575
Sequence length 411
Comment pep:known_by_projection chromosome:CanFam3.1:8:71747186:71764570:1 gene:ENSCAFG00000018317 transcript:ENSCAFT00000043575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHDEEHARACGLPEDTLVLPPASPDQRVIYTVLECQPLFDSSDMTITEWVQIAQTIERH
YEQYHGFVVIHGTDTMAFAASVLSFVLENLQKTVVLTGAQVPIHALWNDGRENLLGALLM
AGQYVIPEVCLFFQNQLFRGNRVTKVDSRRFAAFCSPNLPPLAVVGTDVLINRELVRKAR
GKDRLVVHSSMERDVGLLRLYPGIPAALVRAFLQPPMKGVVMETFGSGNGPTQPELLGEL
QAAAQRGLLILNCTHCLQGAVTSDYAAGMAMAGAGIISGFDMTSEAALAKLSYVLGQPGL
SLDGRKELLARDLRGEMTLPTGHERRPSLSCSTLGRGVAQLLALSQEADAVRDALLPGLA
CAAAHAGNLEALQALVELVRPPRPLGAGPRPRQSWGCRTAGLCQAPFPGAP
Download sequence
Identical sequences J9NUG3
ENSCAFP00000036802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]