SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037826 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037826
Domain Number 1 Region: 27-269
Classification Level Classification E-value
Superfamily CutC-like 2.35e-80
Family CutC-like 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037826   Gene: ENSCAFG00000009524   Transcript: ENSCAFT00000049349
Sequence length 273
Comment pep:known_by_projection chromosome:CanFam3.1:28:12624390:12650787:1 gene:ENSCAFG00000009524 transcript:ENSCAFT00000049349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQGAPSERKRARIPSGKAGTANGFLMEVCVDSVESAVNAERGGAGRIELCSGLLEGGT
TPSMGVLQVVKQCVQIPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLYGADGLVFGALT
EDGNIDKELCMSLVAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALE
GLPLIKRLIDQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSARDSGMKFRNSSV
AMGASLSSSEYSLKVTDVAQVRTLNAIAKNILV
Download sequence
Identical sequences J9NX14
XP_534987.2.84170 ENSCAFP00000037826 ENSCAFP00000014003 9615.ENSCAFP00000014003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]