SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038741 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038741
Domain Number 1 Region: 44-206
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.71e-47
Family Dual specificity phosphatase-like 0.0000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038741   Gene: ENSCAFG00000029801   Transcript: ENSCAFT00000046440
Sequence length 211
Comment pep:known_by_projection chromosome:CanFam3.1:16:31115591:31118030:1 gene:ENSCAFG00000029801 transcript:ENSCAFT00000046440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPGNWLWASMTFMARFSRSSSRSPVRTRGALEEMPAVQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQDIANNRRELRRLGITHVLNASHSRWRGTPEVYQGLGIRYLGVEAHD
SPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIK
KVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Download sequence
Identical sequences J9NZM1
ENSCAFP00000038741 XP_850468.1.84170 ENSCAFP00000038741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]