SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039602 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039602
Domain Number 1 Region: 92-178
Classification Level Classification E-value
Superfamily PUA domain-like 5.9e-19
Family PUA domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000039602
Domain Number - Region: 50-88
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0981
Family Hypothetical protein APE0525, N-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039602   Gene: ENSCAFG00000005346   Transcript: ENSCAFT00000008606
Sequence length 181
Comment pep:known chromosome:CanFam3.1:2:30713796:30714341:1 gene:ENSCAFG00000005346 transcript:ENSCAFT00000008606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQILPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPG
AQLYPAAVDTVVAIMAEGKQHALCVGVMRMSAEDIEKVNKGIGIENIHYLNDGLWHMKTY
K
Download sequence
Identical sequences G1MM59 J9P226
ENSAMEP00000020448 XP_002920386.1.58354 XP_006734818.1.47382 XP_008703617.1.72690 XP_021552433.1.83697 XP_544278.3.84170 ENSAMEP00000020448 ENSCAFP00000039602 ENSCAFP00000039602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]