SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003219 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003219
Domain Number 1 Region: 2-565
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.09e-85
Family Acetyl-CoA synthetase-like 0.0000373
Further Details:      
 
Domain Number 2 Region: 750-1090
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.16e-46
Family Quinoprotein alcohol dehydrogenase-like 0.0082
Further Details:      
 
Domain Number 3 Region: 549-607
Classification Level Classification E-value
Superfamily ACP-like 0.0000118
Family Acyl-carrier protein (ACP) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003219   Gene: ENSCAFG00000002209   Transcript: ENSCAFT00000003472
Sequence length 1094
Comment pep:known_by_projection chromosome:CanFam3.1:13:48576495:48612198:-1 gene:ENSCAFG00000002209 transcript:ENSCAFT00000003472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHQAASIYSDKIAVCFDECNNQPPVYYTYKTVVNAASELSNFLLLHCDFQEIQE
VGLYCHPGINLPSWILGILQVPAAYAPIDPDSPPALSTHFMKKCNLSYILVEKQQINKFK
SSYETLLNYDTPKEYNDLVLFRLHWKNAEASLMLNDRKQNYEKEKMANSTNSENSNAEKT
EERMDVRQKNCLAYVLHTSGTTGIPKIVRVPHACIVPNIQHFRVLFEITQEDVLFLASPL
TFDPSVVEIFVALSSGACLLIVPTSVKMLPSKLAAVLFSHHRVTILQATPTLLRRFGSQL
IKSTVLSASTSLRVLALGGEAFPSLTVLKSWRGVDNKTQIFNVYGITEVSSWATFHRIPE
KFLNSTLKCELPVPLGFPLLGTVVEVRDTDGFTIQEGHGQVFLGGRNRVCFLDDEMTVPL
GTMRATGDLVMVKDGEMFFLGRKDSQIKRHGKRLNIELVQQVAEGLQQVESCAVTWYNQE
KLILFMVSKNDLVKEYIFKELQKHLPSHAIPDELVLIDSLPFTSHGKIDVSELNKIYLNL
KPECKLNGKEELWEKLQYLWKSILNLSEDPLKVSDESLFLNSGGDSLKSIRLLNEIEKLV
GTSVPGLLEIILSSSILEIYNHVLQTVFPDEDLVFSKNYATKRKFSDIYQEETSGKSLHQ
KSVMTLNYDNELTAFTTVSRGSQILSLNSKFLTKLGLCSSAQSSDLISQTNIQNVKSLNP
PALIGKSKDPSCTAKVSEEGTYGTAAKKMELHVRWRSDTGKCVDASPLVVIPAVDESSAT
VYIGSHSHRMMALDLYSGKVKWEQILEDRIESSACISKCGNFIVVGCYNGLVYVLKSNSG
EKYWMFSTEDAVKSSATMDPTTGLLYIGSHDQHSYALDIYKKKCVWKSQCGGTVFSSPCL
SLIPHHLYVATLGGLLLAINPATGNRVWKHSCGKPLFSSPRCCLQYVCIGCVDGNLLCFT
HSGEQVWQFSTSEPIFSSPCTSASEQEIFFGSHDCFIYCCNMKGHLQWKFETTSQVYATP
FAFHYQEGGDEMLLAAASTDGKLWILESKSGRLQSVYELPGEVFSSPVVWESMLIIGCRN
NYVYCLDLLGGYQI
Download sequence
Identical sequences E2RF67
ENSCAFP00000003219 ENSCAFP00000003219 XP_005628278.1.84170 XP_005628279.1.84170 XP_013974295.1.84170 XP_539278.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]