SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003885 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003885
Domain Number 1 Region: 907-1198
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.09e-87
Family Complement components 0.0000166
Further Details:      
 
Domain Number 2 Region: 1279-1397
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.57e-30
Family Alpha-macroglobulin receptor domain 0.0016
Further Details:      
 
Domain Number 3 Region: 742-794
Classification Level Classification E-value
Superfamily E set domains 0.00000000798
Family SVA-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003885   Gene: ENSCAFG00000002663   Transcript: ENSCAFT00000004200
Sequence length 1445
Comment pep:known_by_projection chromosome:CanFam3.1:12:35712735:35838842:1 gene:ENSCAFG00000002663 transcript:ENSCAFT00000004200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRGLLTAAHLVCVWTAVLAAGSRPRFLVTAPGIVRPGGNVTIGVELLEHSPPQVTVKA
ELVKMAANLSVSVLEAEGVFEKGSFKTLILPSLPLNSVDGIYELRVTGRAQDEILFSNST
RLSFETKRMTVFIQTDKSLYKPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWL
SEQSDLGVVSKTFQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCS
LNSRSLNGTVIAKYTYGKPVKGDVTLTFLPLSFWGMKRNITKNFKINGSANFSFNDEEMK
KVMDFSEGLSEHMYLSSPGPVEILATVTESLTGISRNASSNVFFKQHDYIIEFFDYATVL
KPSLNFTATVKVTRADGNRLTFEERRNNVVIIVTQKNSSEYWSRWDSRKQEIESVQVINY
TVPQNGIFKIEFPILDDSSELQLKAFFLNSVSSMAVHGMFKSPSKTYIQLKTRDENIKVG
SPFELVVSGNKRLKELSYMVVSRGQLVAVGKQNSTIFSLTPENSWAPKACIIVYYIEDDG
EIINDVLKIPVQLVFKNKIKLFWSKAHAEPSEKVSLRISVTQPDSTIGIVAVDKSVNLMN
VSNDITMENVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDANLLKDYIDGVYDSVEF
AERFVEENEGYLVDFHDFSSVSNPHVRKHFPETWIWLDTKMGSRIYQEFEVTVPDSITSW
VATAFVISEDLGLGLTSTPVELQAFQPFFIFLNLPYSIIRGEEFALEVTIFNYLKDATEV
EVIIEKSDKFDILMASNEINVTGHQQTILVPSEDGATVLFPIRPTYLGEIPITVTAISPT
ASDAVTQKILVKAEGIEKSYSQSILLDLTDNKLQTPLKTLSFSFPPNTVSGSERVQITAV
GDILGSSINGLASLIRMPYGCGEQNMINFAPNIYVLDYLTKKRQLTENLKEKALSFMRQG
YQRELLYQREDGSFSAFGNDDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGR
QKSNGEFWEPGRVIHSELQGGNKSPVTLTAYIVTSLLGYKKYQPNIDVQESINFLESEFN
RGISDNYTLALITYALSSVGSPKAKEALNMLTWRAEQEGGMQFWVSSESKLSESWQPRSL
DIEVAAYALLSHFLQYRVSEGIPIMRWLSRQRNSLGGFASTQDTIIALKALSEFVALMNT
ERTNIQVTVMGPSSPSPVKFRIDTQNRFLLQTAELAVAQPTAVNISASGFGFAICQFNVI
YNVKDSGSQRRPRSLQDQEAFDLDVVVRDNKDDINHLNLNVCTRFLGPARSGMALMEVNL
LSGFTVPSDAIPLSETVRKVEHDHGKLNLYLDSVNETQICVDIPAVRNFKVSNTQDALVS
IVDYYEPRRQAVRSYNSEVKLSPCDLCGDDHGCSPCERGAAATPCHSTVIVVFCFMLLFS
IQQWL
Download sequence
Identical sequences F1PM26
ENSCAFP00000003885 ENSCAFP00000003885 XP_532205.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]