SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006413 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006413
Domain Number 1 Region: 110-584
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.66e-133
Family Pyridoxal-dependent decarboxylase 0.0000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006413   Gene: ENSCAFG00000004299   Transcript: ENSCAFT00000006929
Sequence length 585
Comment pep:known chromosome:CanFam3.1:2:7365708:7450893:-1 gene:ENSCAFG00000004299 transcript:ENSCAFT00000006929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPGSGFWSFGSEDGSGDPENPSTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SEPPRATSRKAACACNQKPCSCPKAEVNYAFLHATDLLPACDGERPTLAFLQDVMDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMVPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANCGTWNPHKMMGVPLQCSALRVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEY
LYSIIKNREGYEMVFDGKPQHTNVCFWYVPPSLRVLEDNEERMNRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
Download sequence
Identical sequences F1PV66
ENSCAFP00000006413 9615.ENSCAFP00000006413 ENSCAFP00000006413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]