SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008700 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008700
Domain Number 1 Region: 75-169
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-30
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 1-52
Classification Level Classification E-value
Superfamily L27 domain 1.29e-19
Family L27 domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008700   Gene: ENSCAFG00000005817   Transcript: ENSCAFT00000009373
Sequence length 206
Comment pep:known_by_projection chromosome:CanFam3.1:15:23113393:23186348:-1 gene:ENSCAFG00000005817 transcript:ENSCAFT00000009373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRAR
ATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHG
GLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTAR
RRQQQQLLIQQQQQQQQQQTQQNHMS
Download sequence
Identical sequences A0A091D1U0 F1PLC3 F7FZ11 G7N7R4 G7PIK3
ENSCJAP00000035912 ENSCAFP00000008700 ENSCAFP00000008700 ENSCJAP00000035912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]