SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014293 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014293
Domain Number 1 Region: 254-311
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000824
Family BSTI 0.067
Further Details:      
 
Domain Number 2 Region: 721-782
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000419
Family ATI-like 0.01
Further Details:      
 
Domain Number 3 Region: 613-675
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000353
Family BSTI 0.091
Further Details:      
 
Domain Number 4 Region: 772-821
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000513
Family Fibronectin type I module 0.039
Further Details:      
 
Domain Number 5 Region: 303-351
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000973
Family VWC domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014293   Gene: ENSCAFG00000009734   Transcript: ENSCAFT00000015449
Sequence length 1112
Comment pep:novel scaffold:CanFam3.1:JH373378.1:53907:60654:1 gene:ENSCAFG00000009734 transcript:ENSCAFT00000015449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSTWGAGHFSTFDGHVYDFLGTCNYIFAATCKDTSPTFSVQLRRGPGGGISRVIVELGAS
VVTVQKAVISVKVVGLPYTSNGLQITPFGQNVQLVAKQLELELVVMWGPGTHLMVLVEKR
HMGKLCGLCGDFNGEQTNEFLSEEGKFLEPHTYAALQTLDDPDEICTYKAVPNPQVPQAE
HAQTCTQLLTLVAPECNVPKEPFMWSCQVDMAECVLRGQHNCSCATLSEYSRQCSMAGQA
VSNWRGPGLCPVGTCPANQVYQECGETCVKTCSNPQHTCSSFCTFGCFCPKGTVLDDISR
NHTCVPVTQCPCMLNGVVYAPGEVVTAACQTCQCTTGHWKCTEQPCPQRCSLEGGSFVTT
FDARPYRFHGTCTYILLQSPQLPDGASLVASYDKSGYSHSETALAAIIYMSREDKIVISQ
DEVFTHNGNTKWLPYKTRNITVFRQTSTHIQMTTTFGLELVIQLEPVFQAYITIGPQFRG
QTRGLCGTFNGDTTDDFMASTGIVEGTASLFVDSWRTGNCPASLERETDPCSMSQLNKVC
AETHCSVLVRNGSVFEKCHAMVNPRPFYKRCVYQACNYEKTILHVCAALSDYARVCATRG
ILLRDWRNSVDNCTTPCTGNQTFGYDTRACGRTCLSLSDHAAECHPSAVPVDGCNCPEGT
YLNHKAQCVRKSQCPCLLDSNKFILADQSAMVNGVICYCINGRLSCPGRPQMLLATCSAP
KTFQSCNESSENTFGAACAPTCQMLATGTPCVPTRCEPGCVCAEGLYENANGQCVPPEEC
PCEFAGASYPPGAELHTDCRTCTCSRGKWTCWQSARCSSTCALYGEGHVVTFDGQRFMFD
GSCGYILTTDGCGANNSRPTFTVLTENVVCGKSGVTCSRSIKISLGGLSIVLADRNYTVS
GEDPHVHFRVNAGSLNLVLDITISNRYNLTLVWNKHMTIFIKITRATQDALCGLCGNYNG
NMKDDFETRSNYVASSELEFVNSWKDSPLCGDTSLALDPCSLNTFRRAWAERKCGIINSP
TFAACHSQVYHLPYYEACVQDACGCDTTGDCECLCDAVAAYAKACLDKGVCVDWRTPDFC
PIYCDYYNTHTHEDGAYQYNQDANCTWHYQPC
Download sequence
Identical sequences H9GWA1
ENSCAFP00000014293 ENSCAFP00000014293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]