SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018423 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018423
Domain Number 1 Region: 148-241
Classification Level Classification E-value
Superfamily TAFH domain-like 7.32e-36
Family TAFH domain-like 0.00000289
Further Details:      
 
Domain Number 2 Region: 434-481
Classification Level Classification E-value
Superfamily Histone-fold 2.22e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018423   Gene: ENSCAFG00000012509   Transcript: ENSCAFT00000019863
Sequence length 647
Comment pep:known_by_projection chromosome:CanFam3.1:24:46076373:46107696:-1 gene:ENSCAFG00000012509 transcript:ENSCAFT00000019863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGTSPDARSPLSPGMVLVRSENGQLLMIPQQALAQMQAQAHVQTQPQTTMAPRPATPTS
APPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPNTALQRSPGVQPQLVLGGAAQ
TTSLGTATAVQTGTPQRTVPGATTTSTAATETMENVKKCKNFLSTLIKLASSGKQSTETA
ANVKELVQSLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQ
SQQQPPPASQATTALTAVVLSSSAQRTAGKTAATVTGALQPPVISLTQPTQVGVGKQGQP
TPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHSRIVLTAPQQIQLNQLQPVPVVKPAV
LPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSE
LVGTLTRSCKDETFLLPAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKIS
ETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQED
PEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDSPGPGSGTEGSGPGSAV
PGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences F1PV33
ENSCAFP00000018423 ENSCAFP00000018423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]