SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018558 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018558
Domain Number 1 Region: 110-593
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.99e-132
Family Pyridoxal-dependent decarboxylase 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018558   Gene: ENSCAFG00000012560   Transcript: ENSCAFT00000020006
Sequence length 594
Comment pep:novel chromosome:CanFam3.1:36:15351289:15391701:1 gene:ENSCAFG00000012560 transcript:ENSCAFT00000020006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSTPSSSATSSNAGADPNTANLRPTTYDTWCGVAHGCTRKLGLKICGFQGRDLRLSQR
SQLASPPTSQDLPPLLSCDVHDPPRILVSTKTAVGDFPPSDLLPAKNGEEQTVQFLLEVV
DILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVR
TGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSS
KDGDGIFSPGGAISNMYSIMAARYKFFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAAL
GFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIAD
ICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEK
GILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQIN
KCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSPERREKLHRKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
Download sequence
Identical sequences F1PRT3
ENSCAFP00000018558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]