SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020786 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020786
Domain Number 1 Region: 89-514
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.1e-118
Family Pyridoxal-dependent decarboxylase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020786   Gene: ENSCAFG00000014100   Transcript: ENSCAFT00000022384
Sequence length 568
Comment pep:known_by_projection chromosome:CanFam3.1:4:21666395:21718699:1 gene:ENSCAFG00000014100 transcript:ENSCAFT00000022384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTDLLMLKAFEPYFEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVLCTLLIVWVYDFV
FQPESLWSRFKKRCFKLIRKMPIIGRKIQDKVNKTKDDISKNMSFLKVDKEYVKALPSQG
LSASAVLEKLKEYSSMDIFWQEGKASGAVYSGAEELTELLVKAYGDFAWSNPLHPDIFPG
LRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFENGIKTPEIVAPQS
AHAAFDKAANYFGMKIIRVPLNKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPE
VAKLAVRYKIPLHVDACLGGFLIVFMEKAGYPLEQPFDFRVKGVTSISADTHKYGYAPKG
SSVLLYSDKKYRSHQFFVATDWQGGIYASPTIAGSRPGGISAACWAALMHFGESGYVEAT
KQIIKTTRFLKSELETIKGIFVFGNPQLSVIALGSRDFDIYRLFNLMTAKGWNLNQLQFP
PSIHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNLVAE
LSSVFLDSLFSTDTVTPSSQMNGSPKPR
Download sequence
Identical sequences E2RME9
XP_546150.2.84170 ENSCAFP00000020786 ENSCAFP00000020786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]