SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021075 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021075
Domain Number 1 Region: 96-232
Classification Level Classification E-value
Superfamily dUTPase-like 1.18e-48
Family dUTPase-like 0.000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021075   Gene: ENSCAFG00000014277   Transcript: ENSCAFT00000022692
Sequence length 237
Comment pep:known_by_projection chromosome:CanFam3.1:30:14572861:14585767:1 gene:ENSCAFG00000014277 transcript:ENSCAFT00000022692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLCPRPALGSLSSTSWLRSVFKDARGAAPRGEAAGPLFRPLSSTRRPSRGGCRASNVG
RLAERGEAGSAAAAPRAARATPAISPSKRARPAEDGMRLRFVRLSEHATAPTKGSPRAAG
YDLYSAYDYILPPMEKAIVKTDIQVALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRG
NVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGKN
Download sequence
Identical sequences E2RRF8
ENSCAFP00000021075 ENSCAFP00000021075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]