SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028904 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028904
Domain Number 1 Region: 32-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.83e-80
Family Calponin-homology domain, CH-domain 0.000087
Further Details:      
 
Domain Number 2 Region: 1044-1157
Classification Level Classification E-value
Superfamily E set domains 1.47e-37
Family Filamin repeat (rod domain) 0.00000499
Further Details:      
 
Domain Number 3 Region: 1332-1444
Classification Level Classification E-value
Superfamily E set domains 2.8e-36
Family Filamin repeat (rod domain) 0.0000249
Further Details:      
 
Domain Number 4 Region: 1523-1641
Classification Level Classification E-value
Superfamily E set domains 6.34e-34
Family Filamin repeat (rod domain) 0.00000873
Further Details:      
 
Domain Number 5 Region: 457-573
Classification Level Classification E-value
Superfamily E set domains 8.67e-33
Family Filamin repeat (rod domain) 0.00045
Further Details:      
 
Domain Number 6 Region: 1435-1543
Classification Level Classification E-value
Superfamily E set domains 2.34e-32
Family Filamin repeat (rod domain) 0.0000279
Further Details:      
 
Domain Number 7 Region: 1860-1955
Classification Level Classification E-value
Superfamily E set domains 5.07e-31
Family Filamin repeat (rod domain) 0.00000376
Further Details:      
 
Domain Number 8 Region: 2036-2138
Classification Level Classification E-value
Superfamily E set domains 8.53e-31
Family Filamin repeat (rod domain) 0.0000179
Further Details:      
 
Domain Number 9 Region: 671-779
Classification Level Classification E-value
Superfamily E set domains 3.69e-30
Family Filamin repeat (rod domain) 0.00035
Further Details:      
 
Domain Number 10 Region: 1147-1252
Classification Level Classification E-value
Superfamily E set domains 3.07e-29
Family Filamin repeat (rod domain) 0.0000824
Further Details:      
 
Domain Number 11 Region: 1242-1353
Classification Level Classification E-value
Superfamily E set domains 3.47e-29
Family Filamin repeat (rod domain) 0.0000132
Further Details:      
 
Domain Number 12 Region: 850-971
Classification Level Classification E-value
Superfamily E set domains 7.01e-29
Family Filamin repeat (rod domain) 0.00053
Further Details:      
 
Domain Number 13 Region: 2235-2328
Classification Level Classification E-value
Superfamily E set domains 3.2e-27
Family Filamin repeat (rod domain) 0.000004
Further Details:      
 
Domain Number 14 Region: 380-479
Classification Level Classification E-value
Superfamily E set domains 9.34e-27
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 15 Region: 2427-2519
Classification Level Classification E-value
Superfamily E set domains 3.6e-26
Family Filamin repeat (rod domain) 0.00000984
Further Details:      
 
Domain Number 16 Region: 1630-1741
Classification Level Classification E-value
Superfamily E set domains 1.16e-25
Family Filamin repeat (rod domain) 0.0000663
Further Details:      
 
Domain Number 17 Region: 279-375
Classification Level Classification E-value
Superfamily E set domains 4.47e-25
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 18 Region: 2554-2645
Classification Level Classification E-value
Superfamily E set domains 4.8e-25
Family Filamin repeat (rod domain) 0.0000158
Further Details:      
 
Domain Number 19 Region: 2334-2425
Classification Level Classification E-value
Superfamily E set domains 2.6e-24
Family Filamin repeat (rod domain) 0.0000141
Further Details:      
 
Domain Number 20 Region: 564-665
Classification Level Classification E-value
Superfamily E set domains 9.34e-24
Family Filamin repeat (rod domain) 0.00017
Further Details:      
 
Domain Number 21 Region: 768-869
Classification Level Classification E-value
Superfamily E set domains 1.7e-23
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 22 Region: 2156-2249
Classification Level Classification E-value
Superfamily E set domains 8.01e-21
Family Filamin repeat (rod domain) 0.0000115
Further Details:      
 
Domain Number 23 Region: 958-1064
Classification Level Classification E-value
Superfamily E set domains 1e-20
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 24 Region: 1961-2058
Classification Level Classification E-value
Superfamily E set domains 5.47e-18
Family Filamin repeat (rod domain) 0.0000933
Further Details:      
 
Domain Number 25 Region: 1797-1877
Classification Level Classification E-value
Superfamily E set domains 2.2e-16
Family Filamin repeat (rod domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028904   Gene: ENSCAFG00000019521   Transcript: ENSCAFT00000031071
Sequence length 2646
Comment pep:known_by_projection chromosome:CanFam3.1:X:122061570:122083141:1 gene:ENSCAFG00000019521 transcript:ENSCAFT00000031071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSHSRAGQSAAGAAPGGGADTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
GACRAVGRGLQPKGVRVKETADFKVYTKGAGSGDLKVTVKGPKGEERVKQKDLGDGVYGF
EYYPMVPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTFGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAALRVQVQDNEGCPVD
ATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTINAK
AAGKGKPDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGINVTYGGDPIPKSP
FSVGVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKITGPSGTAVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPVEALPPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGMGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEAGQFHVDCSSAGSAELTIEIRSE
AGLPAEVHIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDCGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA
LAGDQPAAQPPLRPQQLAPPYTYAQGGQQTWAPERPLMGVNGLDVTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPAVFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
NLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKTASAPQHGALAGSTDASKVLAKGLGLSKAYVGQKSSFTVD
CSKAGNNMLLVGVHGPRTPCEEILVKHVGNRLYNVSYLLKDKGEYTLVVKWGDEHIPGSP
YRVLVP
Download sequence
Identical sequences F1PWW0
ENSCAFP00000028904 ENSCAFP00000028904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]