SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036020 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036020
Domain Number 1 Region: 20-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 366-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.86e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 5 Region: 459-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000025
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000036020
Domain Number - Region: 214-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00833
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036020   Gene: ENSCAFG00000002372   Transcript: ENSCAFT00000048797
Sequence length 576
Comment pep:known_by_projection chromosome:CanFam3.1:1:99642374:99654992:-1 gene:ENSCAFG00000002372 transcript:ENSCAFT00000048797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEEEPTALAMATGLPAEWLQEPVTFRDVAVDFTQEEWGQLGPAQRTLYRDVMLETFGH
LLSLGPELPKPEVISQLEQGAELWAAEREIAQGYCPGREPGPESQVPPKEHVLPEVDPSH
VTEGEGFLRDAPCPTILREDRECEGQVKLPEKEQDNLRQLEFNLKEAPIQDKSYESLRLG
ENGVLSSNLNPFPEISRIEYLCAYNSQVINSERNSSLVSQQTGSSGKEPCDSSDCSRTSS
QAIPILELTRSQVQDKPYKCTDCGKSFNHNAHLTVHKRIHTGERPYMCKECGKAFSQNSS
LVQHERIHTGDKPYKCAECGKSFCHSTHLTVHRRIHTGEKPYECQDCGRAFNQNSSLGRH
KRTHTGEKPYTCSVCGKSFSRTTCLFLHLRTHTEERPYECNHCGKGFRHSSSLAQHQRKH
AGEKPYECRQRLIFEQTPALTKHEWAEALGCDPPLNPDERAHRSDRPFKCNHCGKCFIQS
SHLIRHQITHTREEPQGRNRRRLEQSFGRTSQLGRHQHTHSSESSGGGTKAGQPASQALA
LFDIHEIMQEKNPVHVIGVEESSMGASVLFDVRESS
Download sequence
Identical sequences J9JHT9
ENSCAFP00000036020 XP_003432737.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]