SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036411 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036411
Domain Number 1 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.38e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-24
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 5 Region: 24-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 615-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 671-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 717-769
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000192
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 466-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000191
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 11 Region: 382-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000608
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 12 Region: 246-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000664
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036411   Gene: ENSCAFG00000015031   Transcript: ENSCAFT00000050155
Sequence length 774
Comment pep:known chromosome:CanFam3.1:X:41032755:41072766:-1 gene:ENSCAFG00000015031 transcript:ENSCAFT00000050155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANRSAPQWSSVLAAEGHGSSCEISMSFEDVTVDFSREEWQHLDSAQRRLYRDVTLENY
SHLCSVGYQVPKPEVIFKLEQGEEPWILETKTPHQSCLDEDVGEMQQQRIPGKVLFHCEK
FGQSIGKNPLCSILEELWQNNNQLERSQESQNNPLSHVRVLIKERGYEYKNIEKIIHVST
KVVPSIKRLHNYDTFGKSLKHTLNLHNHNKSSVTKKLDKIFGNDNLAHSSSSTENANIGA
NSCEINQCEKHLGNKQVLIHHQKIQTGEQLYVCTECVKSFPQKSHLFEHQRIHAEEKSHD
CHKSDKVLIQKPQINVPQSVYTGDKPYICTQCGKAFTLKSNLITHQKIHTGQKPYKCSEC
GKAFFHRSYLFRHMRIHTGEKPYECSECGRGFSQNSDLNIHQKTHTGEKHYACSECGKAF
TRKSALRMHQRIHTGEKPYVCTECGKAFIQKSHFNTHQRIHTGEKPYECSECGKSFTKKS
QLHVHQRIHTGEKPYICTECGKVFTHRTNLTTHQKTHTGEKPYMCAECGKAFSDQSNLIK
HQKTHTGEKPYKCNGCGKAFIWKSRLKIHQKSHIGERHYECNECGKAFIQKSTLSVHQRI
HTGEKPYVCPECGKAFIQKSHFIAHHRIHTGEKPYECSDCGKCFTKKSQLRVHQKIHTGE
KPNICAECGKAFTDRSNLITHQKIHTREKPYKCSDCGKTFTWKSRLTIHQKSHTGERHYE
CNKCGKAFIQKATLSMHQIIHTGKKPYACTECQKAFTDRSNLIKHQKTHSGEKL
Download sequence
Identical sequences J9NTC6
ENSCAFP00000036411 ENSCAFP00000022149 XP_013966898.1.84170 XP_013966899.1.84170 XP_013966900.1.84170 XP_013966901.1.84170 XP_013966902.1.84170 XP_013966903.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]