SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037003 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037003
Domain Number 1 Region: 5-67
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 243-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.16e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 187-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 285-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-20
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 5 Region: 149-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-17
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037003   Gene: ENSCAFG00000032452   Transcript: ENSCAFT00000048408
Sequence length 439
Comment pep:known_by_projection chromosome:CanFam3.1:23:9966661:9979936:1 gene:ENSCAFG00000032452 transcript:ENSCAFT00000048408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQTTWPQEPVTFEDVAVYFTQSQWASLDHAQRDLYREVMLENYANVASLGAFPFPKPVL
VSQLERGEAPWGPDPWEAEVVRCISPGGESWIKKEEPAVKQEAAEEAELHRTLGGGLLRN
VSQHFDFKSKATWQTFSLNPNLILRGGMKFYECKECGKIFRYNSKLIRHQMSHTGEKPFK
CKECGKAFKSSYDCIVHEKNHIGEGPYECKECGKGLSSNTALTQHQRIHTGEKPYECKEC
GKAFRRSAAYLQHQRLHTGEKLYKCKECWKAFGCRSLFIVHQRIHTGEKPYQCKECGKAF
TQKIASIQHQRVHTGEKPYECKVCGKAFKWYGSFVQHQKLHPMEKKPVKVLGPSLMGPPC
PSSAFSAAPIQGPCSAPTVAVPSLTFPHAVLIPTSGPLFMLLPASGMPSSPVQIVHVFQG
LPPTVKPSPVILAPSPHPS
Download sequence
Identical sequences J9NV11
ENSCAFP00000037003 ENSCAFP00000037003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]