SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037870 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037870
Domain Number 1 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 3 Region: 70-123
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-22
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 4 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.98e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000136
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 161-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000239
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000037870
Domain Number - Region: 202-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00014
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037870   Gene: ENSCAFG00000028494   Transcript: ENSCAFT00000047344
Sequence length 541
Comment pep:known chromosome:CanFam3.1:1:100250610:100256624:1 gene:ENSCAFG00000028494 transcript:ENSCAFT00000047344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLRFYLPTCLLLQRAGHSHYWHQGLVYPLSWVPWEEEEHGIDWGGVGCGGDWNVGPMEK
GCLWFHLSPSWQGSVTFEDVVVYFSWEEWGLLDETQRCLYHDVMLENFALVISLGCWYGM
EDEAAVSVQRMSLGKTSSPDPSIWKAQPCEKCVLLGRDILYLAEDQESHHGQKSYTCEAC
GKQLWFSANLRQHQKHNEEKPFRWDMEFVTSYKLHVSGKPFPCGEIGKDFLAILSLLQHQ
ATLKGAKPPSSFEHGESFHGRKSPHTCSDTGKSFSYEHKLFQPQQLHTRESYHDWDDCEK
PFNQSSILSNCQRAYPGTRSYECNECGKSFSQSYNLIQHHRIHTGARPYKCSECGKAFSF
KFRLVQHLQIHTRVRPYACGECGKAFSYSSTLIKHQRVHTREKPYKCGECGNSFSQSSNL
IQHQKIHSGARPYKCNECAKSFSYKCKLVQHLRIHTGERPYECGECGKSFSHRSTLNQHQ
RIHTGARPYKCNECEKSFSQKSNLIQHRRVHTGEKPYECGECGKSFSQSSHIIQHRKLHT
R
Download sequence
Identical sequences J9NX58
ENSCAFP00000037870 ENSCAFP00000037870 XP_013970112.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]