SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038005 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038005
Domain Number 1 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 69-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 468-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 276-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000038005
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00275
Family SCAN domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038005   Gene: ENSCAFG00000032577   Transcript: ENSCAFT00000045875
Sequence length 533
Comment pep:known_by_projection chromosome:CanFam3.1:15:2535919:2547699:-1 gene:ENSCAFG00000032577 transcript:ENSCAFT00000045875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITLPTEASAWVKLRHLKKAKEGAPLWEDVTKMFEGEVLLSQDADETQGESFKDE
VTSAPSTVESQELLTFKDIFVDFTQEEWGQLAPAHRNLYREVMLENYGNLVSVGYQLSKP
GVISQLEKGEEPWLIKRVISGSPSSDLENKTETSKSSLKNDISWEGLHHGLMMEQSTRGN
TLYSTLGRVSKCDKLESHQENQRMGEGQIPLTHKKTLTQERGQESNRFEKSINSSKVIPR
PEGPLRKKDHKYKIPRKRNRYNLDLINHSRNYTRMKTFECNICEKIFKQLIHLTEHMRIH
TGEKPFRCKECGKAFSQSSSLIPHQRIHTGEKPYECKECGKTFRHPSSLTQHVRIHTGEK
PYECGVCEKAFSQSIGLIQHLRTHVREKPFTCKDCGKAFFQIRHLRQHEIIHTGVKPYIC
NVCSKTFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRIHLSIHQRVHTGVKPYECSHCG
KAFRHDSSFAKHQRIHTGEKPYDCNECGKAFSCSSSLIRHCKTHLRNTFSNDM
Download sequence
Identical sequences J9NXJ2
ENSCAFP00000038005 ENSCAFP00000038005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]