SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038152 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038152
Domain Number 1 Region: 66-515
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.43e-133
Family Pyridoxal-dependent decarboxylase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038152   Gene: ENSCAFG00000028789   Transcript: ENSCAFT00000050127
Sequence length 521
Comment pep:known_by_projection chromosome:CanFam3.1:23:13696226:13859981:1 gene:ENSCAFG00000028789 transcript:ENSCAFT00000050127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRHPDRDGPLDGDTHQREMVPSKRSAVLVDGVILNGPTTDARAGEKFVEDACRLIMEEV
VLKATDVSEKVCEWRPPEQLKQLLDLEMRDTGEPHHRLLELCQDVIRYSVKTNHPRFFNQ
LYAGLDYYSLVARFMTEALNPSVYTYEVSPVFLLVEEAVLKKMIEFIGWKEGDGIFNPGG
SVSNMYAMNLARYKYCPDIKEKGLSGLPRLILFTSAECHYSMKKAASFLGIGTENVCFVE
TDGRGKMIPAELEKQIWQASKEGAAPFLVCATSGTTVLGAFDPLDEIADICEKHGLWLHV
DASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAK
ASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLV
EEIKKREGFKLLLEPEYANICFWYIPPSLREMKEGPEFWAKLNLVAPAIKERMMKKGSLM
LGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGRDM
Download sequence
Identical sequences J9NXY5
ENSCAFP00000038152 ENSCAFP00000038152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]